1.67 Rating by CuteStat

donnabellpsychotherapy.com is 1 decade 1 month old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, donnabellpsychotherapy.com is SAFE to browse.

PageSpeed Score
84
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.254.234.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
HostGator Web Hosting Website Startup Guide

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 12
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.254.234.33)

E-rim | Upgrade your bike to an e-bike

- e-rim.com

Simply replace your front bicycle wheel with the E-rim. Instantly receive a 30 miles range with 16 mph top speed. Put on more miles in a breeze.

294,229 $ 30,240.00

EZ Tutorials for Beginner to Advanced - Tutsout

- tutsout.com

If you are in geo1, call us today! Tutsout

Not Applicable $ 8.95

Breakfast Sandwich Maker Recipes

- breakfastsandwichmakerrecipes.com
Not Applicable $ 8.95

Drew Martens | Creative Perceptions

- drewmartens.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- erinappenzoller.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.4.7
Date: Thu, 27 Mar 2014 02:21:10 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 07 May 2009 19:02:19 GMT
Content-Encoding: gzip

Domain Information

Domain Registrar: Launchpad.com Inc.
Registration Date: Mar 20, 2014, 12:00 AM 1 decade 1 month 1 week ago
Last Modified: Mar 20, 2014, 12:00 AM 1 decade 1 month 1 week ago
Expiration Date: Mar 20, 2015, 12:00 AM 9 years 1 month 1 week ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns6489.hostgator.com 192.254.234.252 United States of America United States of America
ns6490.hostgator.com 192.254.234.253 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
donnabellpsychotherapy.com A 14393 IP: 192.254.234.33
donnabellpsychotherapy.com NS 21599 Target: ns6490.hostgator.com
donnabellpsychotherapy.com NS 21599 Target: ns6489.hostgator.com
donnabellpsychotherapy.com SOA 21599 MNAME: ns6489.hostgator.com
RNAME: dnsadmin.gator3245.hostgator.com
Serial: 2014032102
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
donnabellpsychotherapy.com MX 14399 Target: donnabellpsychotherapy.com
donnabellpsychotherapy.com TXT 14399 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Domain Name: DONNABELLPSYCHOTHERAPY.COM
Registry Domain ID:
Registrar WHOIS Server: whois.launchpad.com
Registrar URL: LaunchPad.com
Updated Date: 21-Mar-2014
Creation Date: 21-Mar-2014
Registrar Registration Expiration Date: 21-Mar-2015
Registrar: Launchpad, Inc. (HostGator)
Registrar IANA ID: 955
Registrar Abuse Contact Email: abuse@websitewelcome.com
Registrar Abuse Contact Phone: +1.713-574-5287
Domain Status: clientTransferProhibited
Registry Registrant ID: HG_34892885
Registrant Name: Donna Bell
Registrant Organization: 1
Registrant Street: 611 Craig Street
Registrant City: Chapel HIll
Registrant State/Province: NC
Registrant Postal Code: 27516
Registrant Country: US
Registrant Phone: +1.9199231019
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: dcbell@gmail.com
Registry Admin ID: HG_34892885
Admin Name: Donna Bell
Admin Organization: 1
Admin Street: 611 Craig Street
Admin City: Chapel HIll
Admin State/Province: NC
Admin Postal Code: 27516
Admin Country: US
Admin Phone: +1.9199231019
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: dcbell@gmail.com
Registry Tech ID: HG_34892885
Tech Name: Donna Bell
Tech Organization: 1
Tech Street: 611 Craig Street
Tech City: Chapel HIll
Tech State/Province: NC
Tech Postal Code: 27516
Tech Country: US
Tech Phone: +1.9199231019
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: dcbell@gmail.com
Name Server: ns6489.hostgator.com
Name Server: ns6490.hostgator.com
DNSSEC:Unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net/
>>>Last update of WHOIS database: 2014-03-27T02:21:18+0000Z